Overview

  • Product name

  • Description

    Rabbit polyclonal to SelM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SelM aa 62-143.
    Sequence:

    QDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQE LGFYRKAAPDAQVPPEYVWAPAKPPEETSDHA


    Database link: Q8WWX9

  • Positive control

    • IHC-P: Human thyroid gland tissue. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as Selenoprotein M

     

Properties

Applications

Our Abpromise guarantee covers the use of ab246919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    Selenoprotein M is widely expressed and expressed highly in the mammalian brain. It is localized to the perinuclear structures (Golgi/ER). A growing body of evidence relates selenium to cancer prevention, immune system function, male fertility, cardiovascular disorder, control of the aging and neurodiseases process. Selenoproteins are thought to be responsible for the majority of these biomedical effects of selenium. Approximately 17 selenoproteins have been identified until now. Although the function of many selenoproteins are unknown, some play important roles in antioxidant mechanisms. It has been also implicated in the regulation of signaling pathways through catalysis of thiol/disulfide exchange. The roles of Selenoprotein M have not been clearly identified until present time.
  • Cellular localization

    Cytoplasm; perinuclear region. Endoplasmic reticulum Probable. Golgi apparatus Probable. Note: Localized to perinuclear structures corresponding to Golgi and endoplasmic reticulum.
  • Database links

  • Alternative names

    • Selenoprotein M antibody
    • Selenoprotein SelM antibody
    • SELM antibody
    • SelM protein antibody
    • SEPM antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling SelM using ab246919 at 4 µg/ml (green) in ICC/IF.

  • Paraffin-embedded human thyroid gland tissue stained for SelM using ab246919 at 1/500 dilution in immunohistochemical analysis.

References

ab246919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up