Overview

  • Product name

  • Description

    Rabbit polyclonal to SELS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Orangutan
  • Immunogen

    Synthetic peptide within Human SELS aa 125-175. The exact sequence is proprietary.
    Sequence:

    GKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGAC S


    Database link: Q9BQE4

  • Positive control

    • HeLa, Jurkat and 293T whole cell lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH: 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab190247 was affinity purified using an epitope specific to SELS immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/1000 - 1/5000. Predicted molecular weight: 21 kDa.

Target

  • Relevance

    Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.
  • Cellular localization

    Endoplasmic reticulum; endoplasmic reticulum membrane; single pass membrane protein.
  • Database links

  • Alternative names

    • AD-015 antibody
    • ADO15 antibody
    • MGC104346 antibody
    • MGC2553 antibody
    • SBBI8 antibody
    • selenoprotein S antibody
    • SEPS1 antibody
    • VCP interacting membrane protein antibody
    • VCP-interacting membrane antibody
    • VIMP antibody
    see all

Images

  • All lanes : Anti-SELS antibody (ab190247) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate in NETN buffer
    Lane 2 : HeLa whole cell lysate in RIPA buffer
    Lane 3 : 293T whole cell lysate in NETN buffer
    Lane 4 : Jurkat whole cell lysate in RIPA buffer

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 21 kDa


    Exposure time: 3 minutes
  • Immunoprecipitation analysis of HeLa cell lysate (in NETN buffer, 0.5 or 1.0 mg per IP reaction; 20% of IP loaded) labeling SELS using ab190247 at 6 μg per reaction (lane 1). a Control IgG was used in lane 2. For blotting immunoprecipitated SELS, ab190247 was used at 1 μg/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.

References

ab190247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up