Overview

  • Product name

  • Description

    Rabbit polyclonal to SELS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human SELS aa 71-180.
    Sequence:

    EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWD SMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEG GGACSWRPGR


    Database link: Q9BQE4

  • Positive control

    • IHC-P: Human small intestine tissue. WB: HEK-293, NIH/3T3 and NBT-II cell lysates. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 21 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.
  • Cellular localization

    Endoplasmic reticulum; endoplasmic reticulum membrane; single pass membrane protein.
  • Database links

  • Alternative names

    • AD-015 antibody
    • ADO15 antibody
    • MGC104346 antibody
    • MGC2553 antibody
    • SBBI8 antibody
    • selenoprotein S antibody
    • SEPS1 antibody
    • VCP interacting membrane protein antibody
    • VCP-interacting membrane antibody
    • VIMP antibody
    see all

Images

  • Paraffin embedded human small intestine tissue stained for SELS with ab223721 (1/200 dilution) in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for SELS (green) using ab223721 (4 µg/ml) in ICC/IF.

  • Anti-SELS antibody (ab223721) at 1/100 dilution + HEK-293 (human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 21 kDa

  • All lanes : Anti-SELS antibody (ab223721) at 1/100 dilution

    Lane 1 : NIH/3T3 cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 21 kDa

References

ab223721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up