Overview

  • Product name

    Anti-SEMA3G antibody
  • Description

    Rabbit polyclonal to SEMA3G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SEMA3G aa 601-782. BC098137.
    Sequence:

    LECLPKSPQAAVRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDA GTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLAS TPPKAWYKDILQLIGFANLPRVDEYCERVWCRGTTECSGCFRSRSRGKQA RGKSWAGLELGKKMKSRVHAEHNRTPREVEAT


    Database link: Q9NS98

  • Positive control

    • MDA-MB-281 and LO2 cell lysates. Human fetal pancreas tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200 uL sterile H2O.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 87 kDa.

Target

  • Function

    Has chemorepulsive activities for sympathetic axons. Ligand of NRP2.
  • Sequence similarities

    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Sema domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ00014 antibody
    • MGC119473 antibody
    • Sem2 antibody
    • SEM3G_HUMAN antibody
    • Sema domain immunoglobulin domain (Ig) short basic domain secreted (semaphorin) 3G antibody
    • Sema3g antibody
    • Semaphorin 3G antibody
    • Semaphorin sem2 antibody
    • Semaphorin-3G antibody
    see all

Images

  • All lanes : Anti-SEMA3G antibody (ab197108) at 1/500 dilution

    Lane 1 : MDA-MB-281 cell lysate
    Lane 2 : LO2 cell lysate

    Predicted band size: 87 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human fetal pancreas tissue labeling SEMA3G with ab197108 at a 1/100 dilution.

References

ab197108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up