Overview

  • Product name

  • Description

    Rabbit polyclonal to SEMA6B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SEMA6B aa 451-538.
    Sequence:

    AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLS LELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG


    Database link: Q9H3T3

  • Positive control

    • Human cerebral cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human cerebral cortex tissue labeling SEMA6B with ab204423 at 1/20.

References

ab204423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up