Overview

  • Product name

  • Description

    Rabbit polyclonal to SEMA6D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SEMA6D aa 913-1068.
    Sequence:

    GSMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLERQR GYHKNSSQRHSISAMPKNLNSPNGVLLSRQPSMNRGGYMPTPTGAKVDYI QGTPVSVHLQPSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQT PSVRPL


    Database link: Q8NFY4-1

  • Positive control

    • ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    SEMA6D belongs to the semaphorin family of proteins, which are a large family of secreted and transmembrane proteins, some of which function as repellent signals during axon guidance. SEMA6D shows growth cone collapsing activity on dorsal root ganglion (DRG) neurons in vitro and may be a stop signal for DRG neurons in their target areas, and possibly also for other neurons. It may also be involved in the maintenance and remodeling of neuronal connections.
  • Cellular localization

    Isoforms 1-6: Cell membrane; Single-pass type I membrane protein. Isoform 7: Cytoplasm.
  • Database links

  • Alternative names

    • KIAA1479 antibody
    • Q8NFY4 antibody
    • Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D antibody
    • Semaphorin 6D antibody

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SEMA6D (green) using ab237693 at 1/133 dilution in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

References

ab237693 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up