Anti-SEMAC antibody (ab237690)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SEMAC antibody
See all SEMAC primary antibodies -
Description
Rabbit polyclonal to SEMAC -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human SEMAC aa 163-253.
Sequence:LARDEKGNVLLEDGKGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAI SRSQSLRPTKTESSLNWLQDPAFVASAYIPESLGSLQGDDD
Database link: Q9NPR2 -
Positive control
- IHC-P: Human small intestine and adrenal gland tissues. ICC/IF: HepG2 cells.
-
General notes
This product was previously labelled as SEMA4B
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab237690 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | 1/50 - 1/200. | |
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
SEMA4B belongs to the semaphorin family and contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. -
Cellular localization
Membrane -
Database links
- Entrez Gene: 10509 Human
- Entrez Gene: 20352 Mouse
- SwissProt: Q9NPR2 Human
- SwissProt: Q62179 Mouse
- Unigene: 474935 Human
- Unigene: 275909 Mouse
-
Alternative names
- KIAA1745 antibody
- MGC131831 antibody
- Sema domain immunoglobulin domain (Ig) transmembrane domain (TM) and short cytoplasmic domain (semaphorin) 4B antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SEMAC antibody (ab237690)Paraffin-embedded human small intestine tissue stained for SEMAC using ab237690 at 1/300 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
Immunocytochemistry/ Immunofluorescence - Anti-SEMAC antibody (ab237690)HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SEMAC (green) using ab237690 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.
The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SEMAC antibody (ab237690)Paraffin-embedded human adrenal gland tissue stained for SEMAC using ab237690 at 1/300 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
References
ab237690 has not yet been referenced specifically in any publications.
