Overview

  • Product name

    Anti-Semaphorin 3c antibody
    See all Semaphorin 3c primary antibodies
  • Description

    Rabbit polyclonal to Semaphorin 3c
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human Semaphorin 3c aa 80-130 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    NNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYV C


    Database link: Q99985

  • Positive control

    • Mouse intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    The Semaphorins constitute a large family of secreted and membrane-tethered cell signaling molecules. They have functions in neural development, immunology, cardiac growth, vascular development, lung morphogenesis and axial bone patterning. Semaphorins are defined by the presence of a conserved Sema domain at the N-terminus. These proteins can be classified into eight classes depending on their structure and species origin. Classes 3 through 7 are found in vertebrates; class 3 are secreted, class 7 are GPI-anchored and class 4 through 6 are transmembrane proteins. Two distinct transmembrane receptor families have been identified as Semaphorin receptors. Neuropilins provide binding specificity for the class 3 Semaphorins, whereas Plexins, which also contain a Sema domain serve as signaling partners for class 3 Semaphorins and as functional receptors for transmembrane Semaphorins. Semaphorin 3c inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. It is expressed maximally between days E10-12 with moderate levels from day E13 until birth.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Sema E antibody
    • SEMA3C antibody
    • semaE antibody
    • Semahorin3C antibody
    • Semaphorin E antibody
    • SemaphorinE antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse intestine tissue labeling Semaphorin 3c with ab214309 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References

ab214309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up