Overview

  • Product name

    Anti-Semaphorin 4D/CD100 antibody
    See all Semaphorin 4D/CD100 primary antibodies
  • Description

    Rabbit polyclonal to Semaphorin 4D/CD100
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse Semaphorin 4D/CD100 aa 502-636. Expressed in E.coli.
    Sequence:

    FCEKHGSCEDCVLARDPYCAWSPAIKACVTLHQEEASSRGWIQDMSGDTS SCLDKSKESFNQHFFKHGGTAELKCFQKSNLARVVWKFQNGELKAASPKY GFVGRKHLLIFNLSDGDSGVYQCLSEERVRNKTVS


    Database link: O09126

  • Positive control

    • WB: Recombinant mouse Semaphorin 4D/CD100 protein; mouse serum. IHC-P: Mouse testis tissue.
  • General notes

     This product was previously labelled as Semaphorin 4D

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 96 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
  • Tissue specificity

    Strongly expressed in skeletal muscle, peripheral blood lymphocytes, spleen, and thymus and also expressed at lower levels in testes, brain, kidney, small intestine, prostate, heart, placenta, lung and pancreas, but not in colon and liver.
  • Sequence similarities

    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A8 antibody
    • BB 18 antibody
    • BB18 antibody
    • CD 100 antibody
    • CD100 antibody
    • CD100 antigen antibody
    • Coll 4 antibody
    • COLL4 antibody
    • Collapsin 4 antibody
    • Collapsin4 antibody
    • GR3 antibody
    • Leukocyte activation antigen CD100 antibody
    • M sema G antibody
    • MSEMA antibody
    • SEM4D_HUMAN antibody
    • Sema 4d antibody
    • Sema domain immunoglobulin domain Ig transmembrane domain TM and short cytoplasmic domain semaphorin 4D antibody
    • Sema H antibody
    • SEMA J antibody
    • Sema4d antibody
    • Semacl 2 antibody
    • Semacl2 antibody
    • SemaH antibody
    • SEMAJ antibody
    • Semaphorin 4D antibody
    • Semaphorin C like 2 antibody
    • Semaphorin H antibody
    • Semaphorin J antibody
    • Semaphorin-4D antibody
    • Semaphorin4D antibody
    • SemaphorinJ antibody
    • Semcl 2 antibody
    • Semcl2 antibody
    see all

Images

  • Anti-Semaphorin 4D/CD100 antibody (ab231961) at 1 µg/ml + Recombinant mouse Semaphorin 4D/CD100 protein

    Predicted band size: 96 kDa

  • Anti-Semaphorin 4D/CD100 antibody (ab231961) at 1 µg/ml + Mouse serum

    Predicted band size: 96 kDa

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for Semaphorin 4D/CD100 using ab231961 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

This product has been referenced in:

  • Liang J  et al. Semaphoring 4D is required for the induction of antioxidant stress and anti-inflammatory effects of dihydromyricetin in colon cancer. Int Immunopharmacol 67:220-230 (2019). Read more (PubMed: 30562683) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up