Overview

  • Product name

    Anti-Semenogelin I antibody
    See all Semenogelin I primary antibodies
  • Description

    Rabbit polyclonal to Semenogelin I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Semenogelin I aa 24-310.
    Sequence:

    QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDA NDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHF HRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSK EQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNV VEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNL NQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVS


    Database link: P04279

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.
    Alpha-inhibin-92 and alpha-inhibin-31, derived from the proteolytic degradation of semenogelin, inhibit the secretion of pituitary follicle-stimulating hormone.
  • Tissue specificity

    Seminal vesicle.
  • Sequence similarities

    Belongs to the semenogelin family.
  • Post-translational
    modifications

    Transglutaminase substrate.
    Rapidly cleaved after ejaculation by KLK3/PSA, resulting in liquefaction of the semen coagulum and the progressive release of motile spermatozoa.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha-Inhibin-31 antibody
    • Alpha-Inhibin-92 antibody
    • Cancer/testis antigen 103 antibody
    • CT103 antibody
    • dJ172H20.2 (semenogelin I) antibody
    • dJ172H20.2 antibody
    • MGC14719 antibody
    • Semen coagulating protein antibody
    • Semenogelin antibody
    • Semenogelin I antibody
    • SEMG antibody
    • SEMG1 antibody
    • SEMG1_HUMAN antibody
    • Seminal basic protein antibody
    • seminal vesicle secretory protein 5 antibody
    • SgI antibody
    • Svp-1 antibody
    • Svp5 antibody
    • SVPIIA antibody
    • Svs2 antibody
    • SVS2P antibody
    • Svs2p2 antibody
    • Svs5 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for Semenogelin I with ab238553 at a 1/100 dilution in immunohistochemical analysis.

References

ab238553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up