Overview

  • Product name

  • Description

    Rabbit polyclonal to SENP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SENP1 aa 63-214.
    Sequence:

    RSAAYNPSYYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKS RNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSG SCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGKQFTIAKPT TH


    Database link: Q9P0U3

  • Positive control

    • WB: HeLa, HL60 and Jurkat whole cell lysate (ab7899); Mouse heart, brain, spleen, stomach and skeletal muscle tissue lysates. IHC-P: Human colon cancer tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236094 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 73 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. Deconjugates SUMO1 from HIPK2. Deconjugates SUMO1 from HDAC1, which decreases its transcriptional repression activity.
  • Tissue specificity

    Highly expressed in testis. Expressed at lower levels in thymus, pancreas, spleen, liver, ovary and small intestine.
  • Sequence similarities

    Belongs to the peptidase C48 family.
  • Cellular localization

    Nucleus. Cytoplasm. Shuttles between cytoplasm and nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • SENP 1 antibody
    • SENP1 antibody
    • SENP1_HUMAN antibody
    • Sentrin specific protease 1 antibody
    • Sentrin-specific protease 1 antibody
    • Sentrin/SUMO specific protease 1 antibody
    • Sentrin/SUMO specific protease antibody
    • Sentrin/SUMO specific protease SENP 1 antibody
    • Sentrin/SUMO specific protease SENP1 antibody
    • Sentrin/SUMO-specific protease SENP1 antibody
    • SUMO1/sentrin specific peptidase 1 antibody
    • SUMO1/sentrin specific protease 1 antibody
    • SuPr 2 antibody
    • SuPr2 antibody
    see all

Images

  • All lanes : Anti-SENP1 antibody (ab236094) at 1/500 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HL-60 (Human promyelocytic leukemia cell line) whole cell lysate
    Lane 3 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : Mouse heart tissue lysate
    Lane 5 : Mouse brain tissue lysate
    Lane 6 : Mouse spleen tissue lysate
    Lane 7 : Mouse stomach tissue lysate
    Lane 8 : Mouse skeletal muscle tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 73 kDa

  • Paraffin-embedded human colon cancer tissue stained for SENP1 with ab236094 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for SENP1 (Green) using ab236094 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236094 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236094.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up