Overview

  • Product name

    Anti-SENP2 antibody [OTI1H2]
    See all SENP2 primary antibodies
  • Description

    Mouse monoclonal [OTI1H2] to SENP2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SENP2 aa 139-523. Produced in E.coli (NP_067640).
    Sequence:

    RDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEM ISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSN YHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSE KRCSKGKITDTETMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGL LRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEI LSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERNKKQGYPALHVF STFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRK KCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSD


    Database link: Q9HC62

  • Positive control

    • WB: HEK-293T cells transfected with pCMV6-ENTRY SENP2 cDNA. IHC-P: Human prostate carcinoma, prostate, endometrium adenocarcinoma, pancreas carcinoma, pancreas, ovary adenocarcinoma, lung carcinoma and kidney tissues. Flow Cyt: HeLa and Jurkat cells. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY SENP2.
  • General notes

    Clone OTI1H2 (formerly 1H2).

Properties

Applications

Our Abpromise guarantee covers the use of ab131637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 68 kDa.
IHC-P 1/150.
Flow Cyt 1/100.
ICC/IF 1/100.

Target

  • Function

    Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. May down-regulate CTNNB1 levels and thereby modulate the Wnt pathway.
  • Sequence similarities

    Belongs to the peptidase C48 family.
  • Domain

    The N-terminus is necessary and sufficient for nuclear envelope targeting.
  • Post-translational
    modifications

    Polyubiquitinated; which leads to proteasomal degradation.
  • Cellular localization

    Nucleus > nuclear pore complex. Nucleus membrane. Cytoplasm. Shuttles between cytoplasm and nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Axam2 antibody
    • DKFZp762A2316 antibody
    • KIAA1331 antibody
    • Senp2 antibody
    • SENP2_HUMAN antibody
    • Sentrin specific protease 2 antibody
    • Sentrin-specific protease 2 antibody
    • Sentrin/SUMO specific protease SENP2 antibody
    • Sentrin/SUMO-specific protease SENP2 antibody
    • SMT3 specific isopeptidase 2 antibody
    • SMT3-specific isopeptidase 2 antibody
    • Smt3ip2 antibody
    • SUMO1/sentrin/SMT3 specific peptidase 2 antibody
    see all

Images

  • All lanes : Anti-SENP2 antibody [OTI1H2] (ab131637) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SENP2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 68 kDa

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY SENP2 stained for SENP2 (green) using ab131637 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling SENP2 with ab131637 at 1/100 dilution (Red) compared to a nonspecific negative control antibody (Blue).

  • Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling SENP2 with ab131637 at 1/100 dilution (Red) compared to a nonspecific negative control antibody (Blue).

  • Paraffin-embedded human kidney tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate carcinoma tissue stained for SENP2 using ab131637 at 1/50 dilution in immunohistochemical analysis.

References

ab131637 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up