Overview

  • Product name

  • Description

    Rabbit polyclonal to SENP6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SENP6 aa 1-270.
    Sequence:

    MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDG TNLLSVDEDEDSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKT LKGNPIGLNMLSNNKKLSENTQNTSLCSGTVVHGRRFHHAHAQIPVVKTA AQSSLDRKERKEYPPHVQKVEINPVRLSRLQGVERIMKKTEESESQVEPE IKRKVQQKRHCSTYQPTPPLSPASKKCLTHLEDLQRNCRQAITLNESTGP LLRTSIHQNSGGQKSQNTGL


    Database link: Q9GZR1

  • Positive control

    • ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Function

    Protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Processes preferentially poly-SUMO2 and poly-SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Deconjugates SUMO1 from RXRA, leading to transcriptional activation. Involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation. Desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombinaison.
  • Tissue specificity

    Highly expressed in reproductive organs, such as testis, ovary and prostate.
  • Pathway

    Protein modification; protein sumoylation.
  • Sequence similarities

    Belongs to the peptidase C48 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810017C20Rik antibody
    • FLJ11355 antibody
    • FLJ11887 antibody
    • KIAA0389 antibody
    • KIAA0797 antibody
    • SENP 6 antibody
    • Senp6 antibody
    • SENP6_HUMAN antibody
    • Sentrin specific protease 6 antibody
    • Sentrin-specific protease 6 antibody
    • Sentrin/SUMO specific protease SENP6 antibody
    • Sentrin/SUMO-specific protease SENP6 antibody
    • SSP 1 antibody
    • SSP1 antibody
    • SUMO 1 specific protease 1 antibody
    • SUMO 1 specific protease antibody
    • SUMO-1-specific protease 1 antibody
    • SUMO1 specific protease 1 antibody
    • SUMO1 specific protease antibody
    • SUMO1/sentrin specific peptidase 6 antibody
    • SUSP 1 antibody
    • SUSP1 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling SENP6 using ab234813 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

ab234813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up