Overview

  • Product name

  • Description

    Rabbit polyclonal to SENP7/SSP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SENP7/SSP2 aa 333-467.
    Sequence:

    STISTEFEKPSENYHQDPKLPEEITTKPTKSDFTKLSSLNSQELTLSNAT KSASAGSTTETVENSNSIDIVGISSLVEKDENELNTIEKPILRGHNEGNQ SLISAEPIVVSSDEEGPVEHKSSEILKLQSKQDRE


    Database link: Q9BQF6

  • Positive control

    • IHC-P: Human rectum tissue. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as SENP7

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Protease that deconjugates SUMO2 and SUMO3 from targeted proteins, but not SUMO1. Catalyzes the deconjugation of poly-SUMO2 and poly-SUMO3 chains. Has very low efficiency in processing full-length SUMO proteins to their mature forms.
  • Sequence similarities

    Belongs to the peptidase C48 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1707 antibody
    • Senp7 antibody
    • SENP7_HUMAN antibody
    • Sentrin specific protease antibody
    • Sentrin-specific protease 7 antibody
    • Sentrin/SUMO-specific protease SENP7 antibody
    • SSP2 antibody
    • SUMO 1 specific protease 2 antibody
    • SUMO specific protease antibody
    • SUMO-1-specific protease 2 antibody
    • SUMO1/sentrin specific peptidase 7 antibody
    • SUSP2 antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for SENP7/SSP2 using ab224752 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for SENP7/SSP2 (green) using ab224752 at 4 µg/ml in ICC/IF.

References

ab224752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up