Overview

  • Product name

  • Description

    Rabbit polyclonal to SEPP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SEPP1 aa 20-381.
    Sequence:

    ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKL EDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEEN QTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCE KKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLG SSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPA


    Database link: P49908

  • Positive control

    • WB: Mouse heart, brain and skeletal muscle tissue lysate. IHC-P: Human kidney and thyroid tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 43 kDa (predicted molecular weight: 43 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
ELISA Use at an assay dependent concentration.

Target

  • Function

    Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.
  • Tissue specificity

    Made in the liver and heart and secreted into the plasma. It is also found in the kidney.
  • Sequence similarities

    Belongs to the selenoprotein P family.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Selenoprotein P antibody
    • Selenoprotein P plasma 1 antibody
    • Selp antibody
    • SeP antibody
    • Sepp1 antibody
    • SEPP1_HUMAN antibody
    see all

Images

  • Anti-SEPP1 antibody (ab193193) at 2 µg/ml + Mouse heart tissue lysate

    Secondary
    Polyclonal goat anti-rabbit at 1/10000 dilution

    Predicted band size: 43 kDa
    Observed band size: 43 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling SEPP1 with ab193193 at a dilution of 1/100.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human thyroid tissue labelling SEPP1 with ab193193 at a dilution of 1/100.

  • Immunocytochemistry/Immunofluorescence analysis of HepG2 cells labelling SEPP1 with ab193193 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

  • All lanes : Anti-SEPP1 antibody (ab193193) at 4 µg/ml

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : Mouse skeletal tissue lysate

    Secondary
    All lanes : Polyclonal goat anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa

References

ab193193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up