Overview

  • Product name

  • Description

    Rabbit polyclonal to SEPT5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human SEPT5 aa 77-323. Expressed in E.coli.
    Sequence:

    SAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPIT DYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMK ALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSD EDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQA HCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDS


    Database link: Q99719

  • Positive control

    • WB: Recombinant human SEPT5 protein; Pig brain and heart lysates; HepG2 cell lysate. IHC-P: Human stomach, liver cancer, brain, prostate, breast cancer and pancreas tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab233431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 43 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential). May play a role in platelet secretion.
  • Tissue specificity

    Expressed at high levels in the CNS, as well as in heart and platelets (at protein level).
  • Sequence similarities

    Belongs to the septin family.
  • Post-translational
    modifications

    In platelets, phosphorylated in response to thrombin, phorbol-12-myristate-13-acetate and collagen.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. In platelets, found in areas surrounding alpha-granules.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 Sep antibody
    • CDCrel 1 antibody
    • CDCREL antibody
    • CDCrel-1 antibody
    • CDCREL1 antibody
    • Cell division control related protein 1 antibody
    • Cell division control-related protein 1 antibody
    • H5 antibody
    • HCDCREL 1 antibody
    • OTTHUMP00000197271 antibody
    • OTTHUMP00000197272 antibody
    • OTTHUMP00000197273 antibody
    • OTTHUMP00000197274 antibody
    • OTTHUMP00000197275 antibody
    • OTTHUMP00000197276 antibody
    • OTTHUMP00000197396 antibody
    • OTTHUMP00000197410 antibody
    • Peanut like 1 antibody
    • Peanut like 1 homolog antibody
    • Peanut like protein 1 antibody
    • Peanut-like protein 1 antibody
    • Platelet glycoprotein Ib beta chain antibody
    • PNUTL1 antibody
    • SEPT5 antibody
    • SEPT5_HUMAN antibody
    • Septin 5 antibody
    • Septin-5 antibody
    see all

Images

  • Anti-SEPT5 antibody (ab233431) at 3 µg/ml + Recombinant human SEPT5 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 43 kDa

  • All lanes : Anti-SEPT5 antibody (ab233431) at 3 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Pig heart lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 43 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for SEPT5 using ab233431 at 25 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for SEPT5 using ab233431 at 25 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human brain tissue stained for SEPT5 using ab233431 at 25 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for SEPT5 using ab233431 at 25 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for SEPT5 using ab233431 at 25 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for SEPT5 using ab233431 at 25 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up