Anti-SEPT7 antibody (ab186010)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SEPT7 antibody
See all SEPT7 primary antibodies -
Description
Rabbit polyclonal to SEPT7 -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
-
Immunogen
Synthetic peptide within Human SEPT7 aa 75-125. The exact sequence is proprietary. NP_001779.3
Sequence:LYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNS N
Database link: Q16181 -
Positive control
- HeLa, 293T, Jurkat, TCMK-1, NIH3T3 whole cell lysates,
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7.0-8.0 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab186010 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IP | Use at 2-10 µg/mg of lysate. | |
| WB | 1/2000 - 1/10000. Predicted molecular weight: 51 kDa. |
Target
-
Function
Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Required for normal progress through mitosis. Involved in cytokinesis. Required for normal association of CENPE with the kinetochore. Plays a role in ciliogenesis and collective cell movements. -
Tissue specificity
Widely expressed. -
Sequence similarities
Belongs to the septin family. -
Cellular localization
Cytoplasm. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Cleavage furrow. Midbody. Cytoplasm > cytoskeleton > cilium axoneme. Distributed throughout the cytoplasm in prometaphase cells. Associated with the spindle during metaphase. Associated with the central spindle and at the cleavage furrow in anaphase cells. Detected at the midbody in telophase. Associated with actin stress fibers. - Information by UniProt
-
Database links
- Entrez Gene: 101099705 Cat
- Entrez Gene: 420741 Chicken
- Entrez Gene: 463349 Chimpanzee
- Entrez Gene: 408000 Cow
- Entrez Gene: 100713931 Guinea pig
- Entrez Gene: 100070492 Horse
- Entrez Gene: 989 Human
- Entrez Gene: 235072 Mouse
see all -
Alternative names
- CDC10 antibody
- CDC10 protein homolog antibody
- CDC3 antibody
see all
Images
-
Western blot - Anti-SEPT7 antibody (ab186010)All lanes : Anti-SEPT7 antibody (ab186010) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T cell whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lane 4 : TCMK-1 whole cell lysate
Lane 5 : NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 51 kDa
Exposure time: 30 seconds -
Immunoprecipitation - Anti-SEPT7 antibody (ab186010)Detection of SEPT7 by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells was immunoprecipitated using ab186010 at 6 µg/mg (1), a control rabbit anti-SEPT7 antibody (2) and negative control IgG (3). For blotting immunopreciptated SEPT7 ab186010 was used at 1 µg/ml. ECL with an exposure time of 10 seconds was used for detection.
Datasheets and documents
References
ab186010 has not yet been referenced specifically in any publications.
