Overview

  • Product name

  • Description

    Rabbit polyclonal to SEPT7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SEPT7 aa 187-269.
    Sequence:

    VNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKL VKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPW


    Database link: Q16181

  • Positive control

    • WB: RT4, U-2 OS, NIH/3T3, NBT II and U-251 MG cell lysates; human liber and tonsil tissue lysates. IHC-P: Human fallopian tube, cerebral cortex, testis and lymph node tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 51 kDa.

Target

  • Function

    Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Required for normal progress through mitosis. Involved in cytokinesis. Required for normal association of CENPE with the kinetochore. Plays a role in ciliogenesis and collective cell movements.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the septin family.
  • Cellular localization

    Cytoplasm. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Cleavage furrow. Midbody. Cytoplasm > cytoskeleton > cilium axoneme. Distributed throughout the cytoplasm in prometaphase cells. Associated with the spindle during metaphase. Associated with the central spindle and at the cleavage furrow in anaphase cells. Detected at the midbody in telophase. Associated with actin stress fibers.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDC10 antibody
    • CDC10 protein homolog antibody
    • CDC3 antibody
    • Cell division cycle 10 antibody
    • NBLA02942 antibody
    • SEPT7 antibody
    • SEPT7_HUMAN antibody
    • SEPT7A antibody
    • Septin 7 antibody
    • Septin-7 antibody
    see all

Images

  • All lanes : Anti-SEPT7 antibody (ab244434) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line9 cell lysate
    Lane 2 : NBT II (rat cell line) cell lysate

    Predicted band size: 51 kDa

  • Anti-SEPT7 antibody (ab244434) at 0.4 µg/ml + U-2 OS (human bone osteosarcoma epithelial cell line) cell lysate

    Predicted band size: 51 kDa

  • All lanes : Anti-SEPT7 antibody (ab244434) at 0.4 µg/ml

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 51 kDa

  • Paraffin-embedded human lymph node tissue stained for SEPT7 using ab244434 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for SEPT7 using ab244434 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal muscle tissue stained for SEPT7 using ab244434 at 1/500 dilution in immunohistochemical analysis. No positivity in myocytes, as expected.

  • Paraffin-embedded human cerebral cortex tissue stained for SEPT7 using ab244434 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human fallopian tube tissue stained for SEPT7 using ab244434 at 1/500 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for SEPT7 (green) using ab244434 at 4 μg/ml in ICC/IF.

References

ab244434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up