Overview

  • Product name

  • Description

    Rabbit polyclonal to Septin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Horse, Guinea pig, Cow, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Septin 2 aa 275-325. The exact sequence is proprietary.
    Sequence:

    KLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLE K


    Database link: Q15019

  • Positive control

    • HeLa, 293T, Jurkat, TCMK-1 and NIH3T3 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 41 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Relevance

    The septins are a family of cytoskeletal GTPases that play an essential role in cytokinesis in mammalian cells. Septin 2 (Nedd5) is a mammalian septin known to associate with actin based structures such as the contractile ring and stress fibers. It is involved in cytokinesis and may assemble into a multicomponent structure.
  • Cellular localization

    Cytoplasm. Cytoplasm; cytoskeleton. Cytoplasm; cytoskeleton; spindle. Chromosome; centromere; kinetochore. Cleavage furrow. Midbody. Cytoplasm; cell cortex. Cell projection; cilium membrane.
  • Database links

  • Alternative names

    • DIFF6 antibody
    • hNEDD5 antibody
    • KIAA0158 antibody
    • NEDD 5 antibody
    • NEDD5 antibody
    • Neural precursor cell expressed developmentally down regulated 5 antibody
    • Neural precursor cell expressed developmentally down regulated protein 5 antibody
    • Pnutl3 antibody
    • Protein NEDD5 antibody
    • SEPT2 antibody
    • septin 2 antibody
    see all

Images

  • All lanes : Anti-Septin 2 antibody (ab186020) at 0.1 µg/ml

    Lane 1 : HeLa, whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 41 kDa


    Exposure time: 30 seconds
  • ab186020 at 1 µg/ml detecting Septin 2 in 293T whole cell lysate by WB following IP.  ab186020 was used for IP at 6 µg/mg of lysate, 1 mg of lysate was used for IP and 20% of the IP was loaded.
    Detection: Chemiluminescence with an exposure time of 3 seconds.

References

ab186020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up