Overview

  • Product name

  • Description

    Rabbit polyclonal to Septin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Septin 2 aa 260-359.
    Sequence:

    WGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGR KVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDGDGGALGH


    Database link: Q15019

  • Positive control

    • IHC-P: Human gallbladder tissue. WB: HepG2, NIH/3T3 and NBT-II cell lysates. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 41 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    The septins are a family of cytoskeletal GTPases that play an essential role in cytokinesis in mammalian cells. Septin 2 (Nedd5) is a mammalian septin known to associate with actin based structures such as the contractile ring and stress fibers. It is involved in cytokinesis and may assemble into a multicomponent structure.
  • Cellular localization

    Cytoplasm. Cytoplasm; cytoskeleton. Cytoplasm; cytoskeleton; spindle. Chromosome; centromere; kinetochore. Cleavage furrow. Midbody. Cytoplasm; cell cortex. Cell projection; cilium membrane.
  • Database links

  • Alternative names

    • DIFF6 antibody
    • hNEDD5 antibody
    • KIAA0158 antibody
    • NEDD 5 antibody
    • NEDD5 antibody
    • Neural precursor cell expressed developmentally down regulated 5 antibody
    • Neural precursor cell expressed developmentally down regulated protein 5 antibody
    • Pnutl3 antibody
    • Protein NEDD5 antibody
    • SEPT2 antibody
    • septin 2 antibody
    see all

Images

  • Paraffin-embedded human gallbladder tissue stained for Septin 2 using ab224410 at 1/200 dilution in immunohistochemical analysis.

  • Anti-Septin 2 antibody (ab224410) at 1/100 dilution + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 41 kDa

  • All lanes : Anti-Septin 2 antibody (ab224410) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 41 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Septin 2 (green) using ab224410 at 4 µg/ml in ICC/IF.

References

ab224410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up