Overview

  • Product name

    Anti-SERCA1 ATPase antibody [3D1H6]
    See all SERCA1 ATPase primary antibodies
  • Description

    Mouse monoclonal [3D1H6] to SERCA1 ATPase
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human, Monkey
    Predicted to work with: Rat, Rabbit, Cow
  • Immunogen

    Recombinant fragment corresponding to Human SERCA1 ATPase aa 487-631. Expressed in E.coli.
    Sequence:

    FSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVP LTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLE YETDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGT


    Database link: O14983

  • Positive control

    • WB: Recombinant human SERCA1 ATPase (aa 487-631) protein; SERCA1 ATPase (aa 487-631)-hIgGFc transfected HEK-293 lysate; C2C12, COS-7, HeLa, K562 and Jurkat cell lysates. Flow cyt: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Key regulator of striated muscle performance by acting as the major Ca(2+) ATPase responsible for the reuptake of cytosolic Ca(2+) into the sarcoplasmic reticulum. Catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.
  • Tissue specificity

    Skeletal muscle, fast twitch muscle (type II) fibers.
  • Involvement in disease

    Brody myopathy
  • Sequence similarities

    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily.
  • Developmental stage

    Isoform SERCA1A accounts for more than 99% of SERCA1 isoforms expressed in adult skeletal muscle, while isoform SERCA1B predominates in neo-natal skeletal muscle.
  • Cellular localization

    Endoplasmic reticulum membrane. Sarcoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • fast twitch skeletal muscle isoform antibody
    • AT2A1_HUMAN antibody
    • ATP2A antibody
    • ATP2A1 antibody
    • ATPase Ca++ transporting cardiac muscle fast twitch 1 antibody
    • ATPase Ca++ transporting fast twitch 1 antibody
    • ATPase, Ca(2+)-transporting fast twitch 1 antibody
    • Calcium pump 1 antibody
    • Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform antibody
    • Calcium-transporting ATPase sarcoplasmic reticulum type antibody
    • EC 3.6.3.8 antibody
    • Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody
    • Fast skeletal muscle SR calcium ATPase antibody
    • OTTHUMP00000162561 antibody
    • OTTHUMP00000162562 antibody
    • Sarcoendoplasmic reticulum calcium ATPase antibody
    • Sarcoplasmic reticulum Ca(2+)-ATPase 1 antibody
    • Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 antibody
    • SERCA 1 antibody
    • SERCA1 antibody
    • SERCA1 truncated isoform, included antibody
    • SR Ca(2+) ATPase 1 antibody
    • SR Ca(2+)-ATPase 1 antibody
    see all

Images

  • All lanes : Anti-SERCA1 ATPase antibody [3D1H6] (ab233647) at 1/500 dilution

    Lane 1 : C2C12 (mouse myoblast cell line) cell lysate.
    Lane 2 : COS-7 (African green monkey kidney fibroblast-like cell line) cell lysate.
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate.
    Lane 4 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate.
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate.
  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells using ab233647 (green) at 1/200 dilution compared with a negetive control (red).

  • All lanes : Anti-SERCA1 ATPase antibody [3D1H6] (ab233647) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate.
    Lane 2 : SERCA1 ATPase (aa487-631)-hIgGFc transfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate.
  • Anti-SERCA1 ATPase antibody [3D1H6] (ab233647) at 1/500 dilution + Recombinant human SERCA1 ATPase (aa 487-631) protein.


    Expected MW is 42 kDa.

References

ab233647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up