Anti-SERINC5 antibody (ab204400)
Key features and details
- Rabbit polyclonal to SERINC5
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SERINC5 antibody -
Description
Rabbit polyclonal to SERINC5 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cynomolgus monkey -
Immunogen
Recombinant fragment corresponding to Human SERINC5 aa 335-385.
Sequence:RSSSDALQGRYAAPELEIARCCFCFSPGGEDTEEQQPGKEGPRVIYDEKK G
Database link: Q86VE9 -
Positive control
- Human esophagus tissue; Human tonsil tissue lysate; U-2OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204400 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100 - 1/250. Predicted molecular weight: 47 kDa. | |
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 1 - 4 µg/ml. |
Target
-
Function
Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes. -
Tissue specificity
Highly expressed in placenta, skeletal muscle, spleen, thymus, testis and peripheral leukocyte and is expressed weakly in the heart, liver and fetal brain. -
Sequence similarities
Belongs to the TDE1 family. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 101925282 Cynomolgus monkey
- Entrez Gene: 256987 Human
- Entrez Gene: 218442 Mouse
- Entrez Gene: 170907 Rat
- Omim: 614551 Human
- SwissProt: Q4R6L9 Cynomolgus monkey
- SwissProt: Q86VE9 Human
- SwissProt: Q63175 Mouse
see all -
Alternative names
- C5orf12 antibody
- SERC5_HUMAN antibody
- SERINC5 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERINC5 antibody (ab204400)
Immunohistochemical analysis of paraffin-embedded Human esophagus tissue labeling SERINC5 with ab204400 antibody at a dilution of 1/500.
-
All lanes : Anti-SERINC5 antibody (ab204400) at 1/100 dilution
Lane 1 : Molecular weight marker
Lane 2 : RT-4 cell lysate
Lane 3 : U-251 MG cell lysate
Lane 4 : Human Plasma
Lane 5 : Human liver tissue lysate
Lane 6 : Human tonsil tissue lysate
Developed using the ECL technique.
Predicted band size: 47 kDa -
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling SERINC5 with ab204400 at 4 µg/mL (green).
Protocols
Datasheets and documents
References (2)
ab204400 has been referenced in 2 publications.
- Ahi YS et al. IFITM3 Reduces Retroviral Envelope Abundance and Function and Is Counteracted by glycoGag. mBio 11:N/A (2020). PubMed: 31964738
- Jin SW et al. Natural HIV-1 Nef Polymorphisms Impair SERINC5 Downregulation Activity. Cell Rep 29:1449-1457.e5 (2019). PubMed: 31693887