Overview

  • Product name

    Anti-Serine Palmitoyltransferase antibody
    See all Serine Palmitoyltransferase primary antibodies
  • Description

    Rabbit polyclonal to Serine Palmitoyltransferase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Human Serine Palmitoyltransferase aa 88-562.
    Sequence:

    RDFLRYWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRP ICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGS CQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGM GFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQS LEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKY KAYLYLDEAHSIGALGPTGRGVVEYFGLDPEDVDVMMGTFTKSFGASGGY IGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTSLGKE CVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREML KRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQL KYSRHRLVPLLDRPFDETTYEETED


    Database link: O15270

  • Positive control

    • WB: HepG2, A549 and HT-29 whole cell lysates. IHC-P: Human adrenal gland tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 63 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Serine palmitoyltransferase (SPT). The heterodimer formed with LCB1/SPTLC1 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SSSPTA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC2-SSSPTB complex displays a preference for C18-CoA substrate.
  • Tissue specificity

    Widely expressed.
  • Pathway

    Lipid metabolism; sphingolipid metabolism.
  • Involvement in disease

    Defects in SPTLC2 are the cause of hereditary sensory and autonomic neuropathy type 1C (HSAN1C) [MIM:613640]. It is a form of hereditary sensory and autonomic neuropathy, a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by prominent sensory abnormalities with a variable degree of motor and autonomic dysfunction. The neurological phenotype is often complicated by severe infections, osteomyelitis, and amputations. HSAN1C symptoms include loss of touch and vibration in the feet, dysesthesia and severe panmodal sensory loss in the upper and lower limbs, distal lower limb sensory loss with ulceration and osteomyelitis, and distal muscle weakness.
  • Sequence similarities

    Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0526 antibody
    • LCB 2 antibody
    • LCB2 antibody
    • LCB2a antibody
    • Long chain base biosynthesis protein 2 antibody
    • Long chain base biosynthesis protein 2a antibody
    • Serine palmitoyl CoA transferase 2 antibody
    • Serine palmitoyltransferase 2 antibody
    • Serine palmitoyltransferase long chain base subunit 2 antibody
    • Serine palmitoyltransferase subunit II antibody
    • Serine-palmitoyl-CoA transferase 2 antibody
    • SPT 2 antibody
    • SPT2 antibody
    • SPTC2_HUMAN antibody
    • SPTLC 2 antibody
    • Sptlc2 antibody
    see all

Images

  • All lanes : Anti-Serine Palmitoyltransferase antibody (ab236900) at 1/500 dilution

    Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : A549 (Human lung carcinoma cell line) whole cell lysate
    Lane 3 : HT-29 (Human colorectal adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 63 kDa

  • Paraffin-embedded human adrenal gland tissue stained for Serine Palmitoyltransferase using ab236900 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for Serine Palmitoyltransferase  (green) using ab236900 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up