Anti-Serine racemase antibody (ab219855)
Key features and details
- Rabbit polyclonal to Serine racemase
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Serine racemase antibody
See all Serine racemase primary antibodies -
Description
Rabbit polyclonal to Serine racemase -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment corresponding to Human Serine racemase aa 173-272.
Sequence:QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKL KGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ
Database link: Q9GZT4 -
Positive control
- U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab219855 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. -
Tissue specificity
Brain: expressed at high levels in hippocampus and corpus callosum, intermediate levels in substantia nigra and caudate, and low levels in amygdala, thalamus, and subthalamic nuclei. Expressed in heart, skeletal muscle, kidney and liver. -
Sequence similarities
Belongs to the serine/threonine dehydratase family. -
Post-translational
modificationsS-nitrosylated, leading to decrease the enzyme activity. - Information by UniProt
-
Database links
- Entrez Gene: 525340 Cow
- Entrez Gene: 63826 Human
- Entrez Gene: 27364 Mouse
- Entrez Gene: 303306 Rat
- Omim: 606477 Human
- SwissProt: A0JNI4 Cow
- SwissProt: Q9GZT4 Human
- SwissProt: Q9QZX7 Mouse
see all -
Alternative names
- D serine ammonia lyase antibody
- D serine dehydratase antibody
- D-serine ammonia-lyase antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Serine racemase antibody (ab219855)
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling Serine racemase with ab219855 at 4 µg/ml (green).
Protocols
Datasheets and documents
References (0)
ab219855 has not yet been referenced specifically in any publications.
