Overview

  • Product name

    Anti-Serine racemase antibody
    See all Serine racemase primary antibodies
  • Description

    Rabbit polyclonal to Serine racemase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Serine racemase aa 1-340.
    Sequence:

    MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQ KTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGI PAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIM VHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKAL KPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWP IIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQT VSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV


    Database link: Q9GZT4

  • Positive control

    • WB: Mouse heart and brain tissue lysates. IHC-P: Human heart and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab224620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 37 kDa (predicted molecular weight: 37 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.
  • Tissue specificity

    Brain: expressed at high levels in hippocampus and corpus callosum, intermediate levels in substantia nigra and caudate, and low levels in amygdala, thalamus, and subthalamic nuclei. Expressed in heart, skeletal muscle, kidney and liver.
  • Sequence similarities

    Belongs to the serine/threonine dehydratase family.
  • Post-translational
    modifications

    S-nitrosylated, leading to decrease the enzyme activity.
  • Information by UniProt
  • Database links

  • Alternative names

    • D serine ammonia lyase antibody
    • D serine dehydratase antibody
    • D-serine ammonia-lyase antibody
    • D-serine dehydratase antibody
    • ILV1 antibody
    • ISO1 antibody
    • L serine ammonia lyase antibody
    • L serine dehydratase antibody
    • L-serine ammonia-lyase antibody
    • L-serine dehydratase antibody
    • Serine racemase antibody
    • srr antibody
    • SRR_HUMAN antibody
    see all

Images

  • Paraffin-embedded human heart tissue stained for Serine racemase using ab224620 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for Serine racemase using ab224620 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-Serine racemase antibody (ab224620) at 1/500 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 37 kDa
    Observed band size: 37 kDa

References

ab224620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up