Overview

  • Product name

  • Description

    Mouse polyclonal to Serpin A5
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Serpin A5 aa 17-406. Mature form including the propeptide (AAH08915).
    Sequence:

    ASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQNIF FSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQ ELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSA GAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHK GTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVMGVPYQGNATAL FILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEK VLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAAT GTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGRVNRP


    Database link: P05154

  • Positive control

    • Protein C transfected 293T cell lysate
  • General notes

    Previously labelled as Protein C inhibitor. 

Properties

Applications

Our Abpromise guarantee covers the use of ab172060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.
IHC-P Use at an assay dependent concentration. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Inhibits activated protein C as well as plasminogen activators.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acrosomal serine protease inhibitor antibody
    • IPSP antibody
    • IPSP_HUMAN antibody
    • PAI 3 antibody
    • PAI-3 antibody
    • PAI3 antibody
    • PCI antibody
    • PCI-B antibody
    • PLANH 3 antibody
    • PLANH3 antibody
    • Plasma serine protease inhibitor antibody
    • Plasminogen activator inhibitor 3 antibody
    • Plasminogen activator inhibitor III antibody
    • PROCI antibody
    • Protein C inhibitor antibody
    • Serpin A5 antibody
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 5 antibody
    • Serpin peptidase inhibitor clade A member 5 antibody
    • Serpina5 antibody
    see all

Images

  • ab172060 staining Serpin A5 in Human brainstem (pons) tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde and blocked with 10% serum for 2 hours at 20°C; antigen retrieval was by heat mediation in a citrate buffer, pH6. Samples were incubated with primary antibody (1/200 in 2% serum, 0.5% Triton X-100 in PBS) for 20 hours at 20°C. A Biotin-conjugated Sheep anti-mouse IgG polyclonal (1/250) was used as the secondary antibody.

    See Abreview

  • All lanes : Anti-Serpin A5 antibody (ab172060) at 1 µg/ml

    Lane 1 : Protein C transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 43 kDa

References

ab172060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (brainstem - pons)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate pH 6.0
Permeabilization
No
Specification
brainstem - pons
Blocking step
Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
Fixative
Formaldehyde

Dr. Michael Hurley

Verified customer

Submitted Aug 14 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up