Overview

  • Product name

  • Description

    Rabbit polyclonal to SERPINB13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    synthetic peptide corresponding to a region within N terminal amino acids 107-156 (

    RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT

    ) of Human SERPINB13 (NP_036529)

  • Positive control

    • COLO205 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab97943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Note: Optimal concentration of antibody depends the protein level in a given sample. Our recommended concentrations are the starting point for general use. Customers are advised have to do a series of titration tests to determine optimal concentration. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    May play a role in the proliferation or differentiation of keratinocytes.
  • Tissue specificity

    Skin specific.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • HaCaT UV repressible serpin antibody
    • HaCaT UV-repressible serpin antibody
    • Headpin antibody
    • HSHUR7SEQ antibody
    • HUR7 antibody
    • Hurpin antibody
    • MGC126870 antibody
    • Peptidase inhibitor 13 antibody
    • PI-13 antibody
    • PI13 antibody
    • Protease inhibitor 13 antibody
    • Proteinase inhibitor 13 antibody
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 13 antibody
    • Serpin B13 antibody
    • Serpin peptidase inhibitor clade B (ovalbumin) member 13 antibody
    • SERPINB13 antibody
    • SPB13_HUMAN antibody
    • UV B repressed sequence HUR 7 antibody
    see all

Images

  • Anti-SERPINB13 antibody (ab97943) at 1 µg/ml + COLO205 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa



    Gel concentration: 12%

References

ab97943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (mouse serpin B13 overexpression in 293T)
Gel Running Conditions
Reduced Denaturing (NuPAGE 4-12% Bis-Tris Gel)
Loading amount
10 µg
Specification
mouse serpin B13 overexpression in 293T
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Dr. Chi-Wen Lo

Verified customer

Submitted Feb 03 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up