Overview

  • Product name

    Anti-SERPINB13 antibody [OTI2B6]
    See all SERPINB13 primary antibodies
  • Description

    Mouse monoclonal [OTI2B6] to SERPINB13
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human SERPINB13 aa 1-391. Produced in HEK-293T cells (NP_036529).
    Sequence:

    MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATA SQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDY ELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINS WVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEK FWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPN DIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVL AAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP


    Database link: Q9UIV8

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY SERPINB13 cDNA. IHC-P: Human breast adenocarcinoma, kidney, liver and bladder carcinoma tissues.
  • General notes

    Clone OTI2B6 (formerly 2B6).

Properties

Applications

Our Abpromise guarantee covers the use of ab236412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/2000. Predicted molecular weight: 44 kDa.

Target

  • Function

    May play a role in the proliferation or differentiation of keratinocytes.
  • Tissue specificity

    Skin specific.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • HaCaT UV repressible serpin antibody
    • HaCaT UV-repressible serpin antibody
    • Headpin antibody
    • HSHUR7SEQ antibody
    • HUR7 antibody
    • Hurpin antibody
    • MGC126870 antibody
    • Peptidase inhibitor 13 antibody
    • PI-13 antibody
    • PI13 antibody
    • Protease inhibitor 13 antibody
    • Proteinase inhibitor 13 antibody
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 13 antibody
    • Serpin B13 antibody
    • Serpin peptidase inhibitor clade B (ovalbumin) member 13 antibody
    • SERPINB13 antibody
    • SPB13_HUMAN antibody
    • UV B repressed sequence HUR 7 antibody
    see all

Images

  • All lanes : Anti-SERPINB13 antibody [OTI2B6] (ab236412) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SERPINB13 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 44 kDa

  • Paraffin-embedded human breast adenocarcinoma tissue stained for SERPINB13 using ab236412 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for SERPINB13 using ab236412 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for SERPINB13 using ab236412 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for SERPINB13 using ab236412 at 1/150 dilution in immunohistochemical analysis.

References

ab236412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up