For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    serpinb1pi2-antibody-ab236890.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Blood Fibrinolysis / Thrombolysis
Share by email

Anti-SERPINB1/PI2 antibody (ab236890)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-SERPINB1/PI2 antibody (ab236890)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERPINB1/PI2 antibody (ab236890)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERPINB1/PI2 antibody (ab236890)
  • Immunocytochemistry/ Immunofluorescence - Anti-SERPINB1/PI2 antibody (ab236890)
  • Immunoprecipitation - Anti-SERPINB1/PI2 antibody (ab236890)

Key features and details

  • Rabbit polyclonal to SERPINB1/PI2
  • Suitable for: WB, ICC/IF, IP, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human SERPINB1/PI2 protein (ab114774)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-SERPINB1/PI2 antibody
    See all SERPINB1/PI2 primary antibodies
  • Description

    Rabbit polyclonal to SERPINB1/PI2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human SERPINB1/PI2 aa 1-379.
    Sequence:

    MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNT AAQLSKTFHFNTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNF LPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLAS GMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQ KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQL TLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE NFTADHPFLFFIRHNSSGSILFLGRFSSP


    Database link: P30740
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HepG2, HeLa, A549 and HEK-293T whole cell lysates. IHC-P: Human skin and colon cancer tissue. IC/IF: HeLa cells. IP: HepG2 whole cell lysate.
  • General notes

     This product was previously labelled as SERPINB1

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Blood
    • Fibrinolysis / Thrombolysis
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Protease inhibitors
    • Serine protease inhibitors
    • SERPINs

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • HepG2 whole cell lysate (ab166833)
    • HeLa whole cell lysate (ab29545)
    • A549 whole cell lysate (ab7910)
  • Recombinant Protein

    • Recombinant Human SERPINB1/PI2 protein (ab114774)
  • Related Products

    • Recombinant Human SERPINB1/PI2 protein (ab114774)

Applications

Our Abpromise guarantee covers the use of ab236890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 43 kDa.
ICC/IF 1/50 - 1/200.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Domain

    Reactive bond 1 is specific for reaction with chymotrypsin-like protease such as cathepsin G, chymotrypsin or chymase, while reactive bond 2 is specific for reaction with elastase-like protease such as neutrophyl elastase, proteinase-3, pancreatic elastase or PSA.
  • Cellular localization

    Cytoplasm.
  • Target information above from: UniProt accession P30740 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 1992 Human
    • Omim: 130135 Human
    • SwissProt: P30740 Human
    • Unigene: 381167 Human
    • Alternative names

      • Anti elastase antibody
      • EI antibody
      • ELANH2 antibody
      • Epididymis luminal protein 57 antibody
      • HEL57 antibody
      • ILEU_HUMAN antibody
      • LEI antibody
      • Leukocyte elastase inhibitor antibody
      • M/NEI antibody
      • MNEI antibody
      • Monocyte/neutrophil elastase inhibitor antibody
      • Peptidase inhibitor 2 antibody
      • Pi-2 antibody
      • PI2 antibody
      • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 1 antibody
      • Serpin B1 antibody
      • Serpin peptidase inhibitor clade B (ovalbumin) member 1 antibody
      • serpinb1 antibody
      see all

    Images

    • Western blot - Anti-SERPINB1/PI2 antibody (ab236890)
      Western blot - Anti-SERPINB1/PI2 antibody (ab236890)
      All lanes : Anti-SERPINB1/PI2 antibody (ab236890) at 1/500 dilution

      Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
      Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
      Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
      Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

      Predicted band size: 43 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERPINB1/PI2 antibody (ab236890)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERPINB1/PI2 antibody (ab236890)

      Paraffin-embedded human skin tissue stained for SERPINB1/PI2 using ab236890 at 1/100 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERPINB1/PI2 antibody (ab236890)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERPINB1/PI2 antibody (ab236890)

      Paraffin-embedded human colon cancer tissue stained for SERPINB1/PI2 using ab236890 at 1/200 dilution in immunohistochemical analysis.

      After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

    • Immunocytochemistry/ Immunofluorescence - Anti-SERPINB1/PI2 antibody (ab236890)
      Immunocytochemistry/ Immunofluorescence - Anti-SERPINB1/PI2 antibody (ab236890)

      HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SERPINB1/PI2(green) using ab236890 at 1/66 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI (blue).

      The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.

    • Immunoprecipitation - Anti-SERPINB1/PI2 antibody (ab236890)
      Immunoprecipitation - Anti-SERPINB1/PI2 antibody (ab236890)

      SERPINB1/PI2 was immunoprecipitated from 0.5 mg HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab236890 at 1/200 dilution. 

      Lane 1: Control rabbit IgG IP (1 μg) in HepG2 whole cell lysate.

      Lane 2: ab236890 IP in HepG2 whole cell lysate.

      Lane 3: HepG2 whole cell lysate 20 μg (Input).

      For western blotting, a HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab236890? Please let us know so that we can cite the reference in this datasheet.

    ab236890 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab236890.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.