Anti-SERPINB1/PI2 antibody (ab236890)
Key features and details
- Rabbit polyclonal to SERPINB1/PI2
- Suitable for: WB, ICC/IF, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SERPINB1/PI2 antibody
See all SERPINB1/PI2 primary antibodies -
Description
Rabbit polyclonal to SERPINB1/PI2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human SERPINB1/PI2 aa 1-379.
Sequence:MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNT AAQLSKTFHFNTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNF LPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLAS GMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQ KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQL TLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE NFTADHPFLFFIRHNSSGSILFLGRFSSP
Database link: P30740 -
Positive control
- WB: HepG2, HeLa, A549 and HEK-293T whole cell lysates. IHC-P: Human skin and colon cancer tissue. IC/IF: HeLa cells. IP: HepG2 whole cell lysate.
-
General notes
This product was previously labelled as SERPINB1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236890 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 43 kDa. | |
ICC/IF | 1/50 - 1/200. | |
IP | 1/200 - 1/2000. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3. -
Sequence similarities
Belongs to the serpin family. Ov-serpin subfamily. -
Domain
Reactive bond 1 is specific for reaction with chymotrypsin-like protease such as cathepsin G, chymotrypsin or chymase, while reactive bond 2 is specific for reaction with elastase-like protease such as neutrophyl elastase, proteinase-3, pancreatic elastase or PSA. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 1992 Human
- Omim: 130135 Human
- SwissProt: P30740 Human
- Unigene: 381167 Human
-
Alternative names
- Anti elastase antibody
- EI antibody
- ELANH2 antibody
see all
Images
-
All lanes : Anti-SERPINB1/PI2 antibody (ab236890) at 1/500 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 43 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERPINB1/PI2 antibody (ab236890)
Paraffin-embedded human skin tissue stained for SERPINB1/PI2 using ab236890 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SERPINB1/PI2 antibody (ab236890)
Paraffin-embedded human colon cancer tissue stained for SERPINB1/PI2 using ab236890 at 1/200 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SERPINB1/PI2(green) using ab236890 at 1/66 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI (blue).
The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.
-
SERPINB1/PI2 was immunoprecipitated from 0.5 mg HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab236890 at 1/200 dilution.
Lane 1: Control rabbit IgG IP (1 μg) in HepG2 whole cell lysate.
Lane 2: ab236890 IP in HepG2 whole cell lysate.
Lane 3: HepG2 whole cell lysate 20 μg (Input).
For western blotting, a HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236890 has not yet been referenced specifically in any publications.