Overview

  • Product name

    Anti-SerpinB2/PAI-2 antibody
    See all SerpinB2/PAI-2 primary antibodies
  • Description

    Rabbit polyclonal to SerpinB2/PAI-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat SerpinB2/PAI-2 aa 154-408. Expressed in E. coli. N-terminal tags.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFPEAVDFLECANEAR KKINSWVKTQTKGEIPNLLPEGSVDEDTKMVLVNTIYFKGRWKTPFQKRL NGLYPFRVNLNESKPVQMMYLREKLNIGYIKDLKTQILELPYIGNISMFL LLPDEIEDSSTGLEMLEREINFDNFNKWISKETLDEDDVLVYIPKFKLAQ NYELKPILQRMGMEDAFNKGKADFSGMSESNDLFLSEVFHQATVDVNEEG TVAAGGTGAVMTGRTGHGGPQFVADHPFLFFIMNNITRTI


    Database link: P29524

  • Positive control

    • WB: Recombinant rat SerpinB2/PAI-2 protein; MCF7 cell lysate.
  • General notes

    Previously labelled as SerpinB2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab231625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 47 kDa.

Target

  • Function

    Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Post-translational
    modifications

    The signal sequence is not cleaved.
  • Cellular localization

    Cytoplasm. Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • HsT1201 antibody
    • Monocyte Arg serpin antibody
    • Monocyte Arg-serpin antibody
    • Monocyte Arginine-serpin antibody
    • Monocyte-derived plasminogen activator inhibitor antibody
    • PAI antibody
    • PAI-2 antibody
    • PAI2 antibody
    • PAI2_HUMAN antibody
    • Placental plasminogen activator inhibitor antibody
    • PLANH2 antibody
    • Plasminogen activator inhibitor 2 antibody
    • plasminogen activator inhibitor, type 2 antibody
    • plasminogen activator inhibitor, type II (arginine-serpin) antibody
    • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 2 antibody
    • Serpin B2 antibody
    • serpin peptidase inhibitor, clade B (ovalbumin), member 2 antibody
    • Serpinb2 antibody
    • Urokinase inhibitor antibody
    see all

Images

  • Anti-SerpinB2/PAI-2 antibody (ab231625) at 1 µg/ml + MCF7 (Human breast adenocarcinoma cell line) cell lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 47 kDa

  • Anti-SerpinB2/PAI-2 antibody (ab231625) at 2 µg/ml + Recombinant rat SerpinB2/PAI-2 protein

    Predicted band size: 47 kDa

References

ab231625 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up