Overview

  • Product name

    Anti-SerpinB3/SCCA antibody
    See all SerpinB3/SCCA primary antibodies
  • Description

    Rabbit polyclonal to SerpinB3/SCCA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human SerpinB3/SCCA aa 211-390. Expressed in E. coli. N-terminal tags.
    Sequence:

    QMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEK LTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNG DADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN EEFHCNHPFLFFIRQNKTNSILFYGRFSSP


    Database link: P29508-1

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human SerpinB3/SCCA protein. Human lung and pig cerebrum lysate.
  • General notes

    Protein previously labeled as SerpinB3.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    May act as a protease inhibitor to modulate the host immune response against tumor cells.
  • Tissue specificity

    Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Developmental stage

    Its expression is closely related to cellular differentiation in both normal and malignant squamous cells.
  • Cellular localization

    Cytoplasm. Seems to also be secreted in plasma by cancerous cells but at a low level.
  • Information by UniProt
  • Database links

  • Alternative names

    • HsT1196 antibody
    • Protein T4 A antibody
    • Protein T4-A antibody
    • SCC antibody
    • SCCA antibody
    • SCCA PD antibody
    • SCCA-1 antibody
    • SCCA-PD antibody
    • SCCA1 antibody
    • SCCAPD antibody
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 3 antibody
    • Serpin B3 antibody
    • Serpin peptidase inhibitor clade B (ovalbumin) member 3 antibody
    • serpin peptidase inhibitor, clade B (ovalbumin), member 3 antibody
    • SERPINB3 antibody
    • SPB3_HUMAN antibody
    • Squamous cell carcinoma antigen 1 antibody
    • T4 A antibody
    • T4-A antibody
    • T4A antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded kidney tissue stained for SerpinB3/SCCA with ab231201 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SerpinB3/SCCA antibody (ab231201) at 1 µg/ml + Pig cerebrum lysate

    Secondary
    HRP-linked Goat Anti-Rabbit at 0.2 µg/ml
  • Anti-SerpinB3/SCCA antibody (ab231201) at 1 µg/ml + Human lung lysate

    Secondary
    HRP-linked Goat Anti-Rabbit at 0.2 µg/ml
  • Anti-SerpinB3/SCCA antibody (ab231201) at 2 µg/ml + Recombinant human SerpinB3/SCCA protein

References

ab231201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up