Overview

  • Product name

    Anti-SerpinB3/SCCA antibody [OTI1A5]
    See all SerpinB3/SCCA primary antibodies
  • Description

    Mouse monoclonal [OTI1A5] to SerpinB3/SCCA
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human SerpinB3/SCCA aa 1-390. Produced in HEK-293T cell (NP_008850).
    Sequence:

    MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTA QQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYE LKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSW VESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKF WPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNE IDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLR TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP


    Database link: P29508

  • Positive control

    • IHC-P: Human kidney, lung carcinoma, pancreas and bladder carcinoma tissues. WB: HEK-293T cell lysate transfected with pCMV6-ENTRY SerpinB3/SCCA cDNA.
  • General notes

    Clone OTI1A5 (formerly 1A5).

    Protein previously labeled as SerpinB3.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI1A5
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 45 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May act as a protease inhibitor to modulate the host immune response against tumor cells.
  • Tissue specificity

    Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Developmental stage

    Its expression is closely related to cellular differentiation in both normal and malignant squamous cells.
  • Cellular localization

    Cytoplasm. Seems to also be secreted in plasma by cancerous cells but at a low level.
  • Information by UniProt
  • Database links

  • Alternative names

    • HsT1196 antibody
    • Protein T4 A antibody
    • Protein T4-A antibody
    • SCC antibody
    • SCCA antibody
    • SCCA PD antibody
    • SCCA-1 antibody
    • SCCA-PD antibody
    • SCCA1 antibody
    • SCCAPD antibody
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 3 antibody
    • Serpin B3 antibody
    • Serpin peptidase inhibitor clade B (ovalbumin) member 3 antibody
    • serpin peptidase inhibitor, clade B (ovalbumin), member 3 antibody
    • SERPINB3 antibody
    • SPB3_HUMAN antibody
    • Squamous cell carcinoma antigen 1 antibody
    • T4 A antibody
    • T4-A antibody
    • T4A antibody
    see all

Images

  • All lanes : Anti-SerpinB3/SCCA antibody [OTI1A5] (ab180396) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SerpinB3/SCCA cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 45 kDa

  • Paraffin-embedded human kidney tissue stained for SerpinB3/SCCA using ab180396 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung carcinoma tissue stained for SerpinB3/SCCA using ab180396 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for SerpinB3/SCCA using ab180396 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for SerpinB3/SCCA using ab180396 at 1/150 dilution in immunohistochemical analysis.

References

ab180396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up