Overview

  • Product name

    Anti-SerpinB4/SCCA-2 antibody
    See all SerpinB4/SCCA-2 primary antibodies
  • Description

    Rabbit polyclonal to SerpinB4/SCCA-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit
  • Immunogen

    Synthetic peptide corresponding to Human SerpinB4/SCCA-2 aa 35-84 (N terminal).
    Sequence:

    TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ


    Database link: NP_002965

  • Positive control

    • HepG2 cell lysate
  • General notes

    Previously labelled as SERPINB4. 

Properties

Applications

Our Abpromise guarantee covers the use of ab104338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    May act as a protease inhibitor to modulate the host immune response against tumor cells.
  • Tissue specificity

    Squamous cells.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization

    Cytoplasm. Seems to also be secreted in plasma by cancerous cells but at a low level.
  • Information by UniProt
  • Database links

  • Alternative names

    • Leupin antibody
    • Peptidase inhibitor 11 antibody
    • PI 11 antibody
    • PI-11 antibody
    • PI11 antibody
    • Protease inhibitor (leucine serpin) antibody
    • SCCA 2 antibody
    • SCCA-2 antibody
    • SCCA1 antibody
    • SCCA2 antibody
    • SCCA2/SCCA1 fusion protein antibody
    • Serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4 antibody
    • Serpin B4 antibody
    • Serpin peptidase inhibitor, clade B (ovalbumin), member 4 antibody
    • SERPINB 4 antibody
    • SERPINB4 antibody
    • SPB4_HUMAN antibody
    • Squamous cell carcinoma antigen 1 antibody
    • Squamous cell carcinoma antigen 2 antibody
    see all

Images

  • Anti-SerpinB4/SCCA-2 antibody (ab104338) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size: 45 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Pavlikova N  et al. Differentially expressed proteins in human breast cancer cells sensitive and resistant to paclitaxel. Int J Oncol 45:822-30 (2014). Read more (PubMed: 24898082) »
  • Harden CJ  et al. Evaluation of the salivary proteome as a surrogate tissue for systems biology approaches to understanding appetite. J Proteomics : (2011). Read more (PubMed: 22200674) »
See all 2 Publications for this product

Customer reviews and Q&As

Question
Answer

Thank you for contacting us.

We have many antibodies which would work, however I can recommend you the ab97051 from our new AbExcel range. It will give you very good results in Western blot with the ab104338. https://www.abcam.com/index.html?datasheet=97051 (or use the following: https://www.abcam.com/index.html?datasheet=97051).

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up