Overview

  • Product name

    Anti-SerpinB6/CAP antibody
    See all SerpinB6/CAP primary antibodies
  • Description

    Rabbit polyclonal to SerpinB6/CAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human SerpinB6/CAP aa 1-376. (Expressed in E.coli).
    Sequence:

    MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTA AQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSC DFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELL SPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMM FKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTY EKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA DFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFC ADHPFLFFIQHSKTNGILFCGRFSSP


    Database link: P35237

  • Positive control

    • WB: Recombinant human SerpinB6/CAP protein; Human lung lysate. IHC-P: Human prostate, prostate cancer, glioma, kidney, cerebrum and liver tissues.
  • General notes

    Product previously known as Anti-SerpinB6 antibody.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233229 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 43 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May be involved in the regulation of serine proteinases present in the brain or extravasated from the blood (By similarity). Inhibitor of cathepsin G, kallikrein-8 and thrombin. May play an important role in the inner ear in the protection against leakage of lysosomal content during stress and loss of this protection results in cell death and sensorineural hearing loss.
  • Tissue specificity

    Expressed in keratinocytes (at protein level). Highest levels in skeletal muscle. Also found in placenta, cardiac muscle, lung, liver, kidney and pancreas. Expressed in the inner ear hair cells. Expressed abundantly by normal mast cells in different tissues and by mast cells in mastocytoma lesions.
  • Involvement in disease

    Defects in SERPINB6 are the cause of deafness autosomal recessive type 91 (DFNB91) [MIM:613453]. It is a form of non-syndromic deafness characterized by progressive and age-dependent sensorineural hearing loss. Vestibular function is normal.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAP antibody
    • Cytoplasmic antiproteinase antibody
    • Peptidase inhibitor 6 antibody
    • PI-6 antibody
    • PI6 antibody
    • Placental thrombin inhibitor antibody
    • Protease inhibitor 6 (placental thrombin inhibitor) antibody
    • PTI antibody
    • Serpin B6 antibody
    • SERPINB6 antibody
    • SPB6_HUMAN antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for SerpinB6/CAP using ab233229 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for SerpinB6/CAP using ab233229 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for SerpinB6/CAP using ab233229 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for SerpinB6/CAP using ab233229 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for SerpinB6/CAP using ab233229 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for SerpinB6/CAP using ab233229 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SerpinB6/CAP antibody (ab233229) at 3 µg/ml + Recombinant human SerpinB6/CAP protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 43 kDa

  • Anti-SerpinB6/CAP antibody (ab233229) at 3 µg/ml + Human lung lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 43 kDa

References

ab233229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up