Overview

  • Product name

  • Description

    Rabbit polyclonal to SerpinB7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SerpinB7 aa 203-334.
    Sequence:

    KAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVLLPENDLSEIENK LTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDE SKADLSGIASGGRLYISRMMHKSYIEVTEEGT


    Database link: O75635

  • Positive control

    • IHC-P: Human skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Might function as an inhibitor of Lys-specific proteases. Might influence the maturation of megakaryocytes via its action as a serpin.
  • Tissue specificity

    Predominantly expressed in mesangial cells.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Megsin antibody
    • Mesangium predominant gene megsin antibody
    • MGC120014 antibody
    • MGC120015 antibody
    • Serpin B7 antibody
    • Serpin peptidase inhibitor clade B (ovalbumin) member 7 antibody
    • Serpinb7 antibody
    • SPB7_HUMAN antibody
    • TP55 antibody
    see all

Images

  • Paraffin-embedded human skin tissue stained for SerpinB7 using ab224456 at 1/200 dilution in immunohistochemical analysis.

References

ab224456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up