Overview

  • Product name

    Anti-SERPINE3 antibody
  • Description

    Rabbit polyclonal to SERPINE3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SERPINE3 aa 339-417.
    Sequence:

    YVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREP NTGITVFFDRIQIIYQCLSSNKGSFVHYP


    Database link: A8MV23-1

  • Positive control

    • Human stomach cancer, colon and liver tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Probable serine protease inhibitor.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • nexin-related serine protease inhibitor antibody
    • SERP3_HUMAN antibody
    • Serpin E3 antibody
    • serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 antibody
    • SERPINE3 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue, labeling SERPINE3 using ab188155 at a 1/200 dilution.

References

ab188155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up