Overview

  • Product name

    Anti-Serum Amyloid P/SAP antibody
    See all Serum Amyloid P/SAP primary antibodies
  • Description

    Rabbit polyclonal to Serum Amyloid P/SAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Serum Amyloid P/SAP aa 23-223. N-terminal His-tag and GST-tag; Expressed in E.coli.
    Sequence:

    LSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYN TQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSG IAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGE IGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVW V


    Database link: P02743

  • Positive control

    • WB: Human serum; Human urine; Recombinant human Serum Amyloid P/SAP protein. IHC-P: Human liver, glioma, kidney, stomach cancer, liver cancer and lung cancer tissue.
  • General notes

    Previously labelled as Serum Amyloid P.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 25 kDa.
IHC-P Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. May also function as a calcium-dependent lectin.
  • Tissue specificity

    Found in serum and urine.
  • Involvement in disease

    Note=SAP is a precursor of amyloid component P which is found in basement membrane and associated with amyloid deposits.
  • Sequence similarities

    Belongs to the pentaxin family.
    Contains 1 pentaxin domain.
  • Post-translational
    modifications

    N-glycosylated with a complex biantennary oligosaccharide chain with a sialic acid at the end (disialo-SAP). Monosialo-SAP as well as asioalo-SAP are also detected (PubMed:15174148).
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9.5S alpha 1 glycoprotein antibody
    • 9.5S alpha-1-glycoprotein antibody
    • Amyloid P component serum antibody
    • APCS antibody
    • MGC88159 antibody
    • Pentaxin related antibody
    • Pentraxin 2 antibody
    • PTX 2 antibody
    • PTX2 antibody
    • SAMP_HUMAN antibody
    • SAP antibody
    • Serum Amyloid P antibody
    • Serum amyloid P component antibody
    • Serum amyloid P-component(1-203) antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Serum Amyloid P/SAP using ab233265 at 30 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for Serum Amyloid P/SAP using ab233265 at 30 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for Serum Amyloid P/SAP using ab233265 at 30 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Serum Amyloid P/SAP using ab233265 at 30 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for Serum Amyloid P/SAP using ab233265 at 30 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Serum Amyloid P/SAP using ab233265 at 30 ug/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-Serum Amyloid P/SAP antibody (ab233265) at 2 µg/ml

    Lane 1 : Human serum
    Lane 2 : Human urine

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 25 kDa

  • Anti-Serum Amyloid P/SAP antibody (ab233265) at 2 µg/ml + Recombinant human Serum Amyloid P/SAP protein

    Predicted band size: 25 kDa

References

ab233265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up