Overview

  • Product name

    Anti-Seryl-tRNA synthetase/SERS antibody
    See all Seryl-tRNA synthetase/SERS primary antibodies
  • Description

    Rabbit polyclonal to Seryl-tRNA synthetase/SERS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Cow, Cynomolgus monkey, Chinese hamster, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Seryl-tRNA synthetase/SERS aa 2-233.
    Sequence:

    VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRAD NLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVS QIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDV DNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLV FLEQALIQYALRTLGSRGYIPIYTPFFMRKEV


    Database link: P49591

  • Positive control

    • WB: EC109 and HEK-293T whole cell lysates. IHC-P: Human placenta and melanoma tissues.
  • General notes

     This product was previously labelled as Seryl-tRNA synthetase

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 59 kDa.

Target

  • Function

    Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).
  • Pathway

    Aminoacyl-tRNA biosynthesis; selenocysteinyl-tRNA(Sec) biosynthesis; L-seryl-tRNA(Sec) from L-serine and tRNA(Sec): step 1/1.
  • Sequence similarities

    Belongs to the class-II aminoacyl-tRNA synthetase family. Type-1 seryl-tRNA synthetase subfamily.
  • Domain

    Consists of two distinct domains, a catalytic core and a N-terminal extension that is involved in tRNA binding.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • C78314 antibody
    • cytoplasmic antibody
    • EC 6.1.1.11 antibody
    • FLJ36399 antibody
    • sarS antibody
    • Sars1 antibody
    • Serine tRNA ligase 1, cytoplasmic antibody
    • Serine tRNA ligase antibody
    • Serine--tRNA ligase antibody
    • serine--tRNA ligase, cytoplasmic antibody
    • SerRS antibody
    • SERS antibody
    • Seryl tRNA Ser/Sec synthetase antibody
    • Seryl tRNA synthetase antibody
    • Seryl tRNA synthetase cytoplasmic antibody
    • Seryl-tRNA Ser/Sec synthetase antibody
    • Seryl-tRNA synthetase antibody
    • seryl-tRNA synthetase, cytoplasmic antibody
    • Seryl-tRNA(Ser/Sec) synthetase antibody
    • Strs antibody
    • SYSC_HUMAN antibody
    see all

Images

  • All lanes : Anti-Seryl-tRNA synthetase/SERS antibody (ab235789) at 1/1000 dilution

    Lane 1 : EC109 whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/15000 dilution

    Predicted band size: 59 kDa

  • Paraffin-embedded human placenta tissue stained for Seryl-tRNA synthetase/SERS using ab235789 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human melanoma tissue stained for Seryl-tRNA synthetase/SERS using ab235789 at 1/100 dilution in immunohistochemical analysis.

References

ab235789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up