Overview

  • Product name

    Anti-SETD5 antibody
  • Description

    Rabbit polyclonal to SETD5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SETD5 aa 551-635.
    Sequence:

    ETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEK LVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQ


    Database link: Q9C0A6

  • Positive control

    • Human nasopharynx tissue, U-2 OS cell line

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab204363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling SETD5 with ab204363 at 4 µg/mL (Green)

     

  • Immunohistochemical analysis of paraffin-embedded Human nasopharynx tissue labeling SETD5 with ab204363 at 1/50 dilution.

References

This product has been referenced in:

  • Villain G  et al. miR-126-5p promotes retinal endothelial cell survival through SetD5 regulation in neurons. Development 145:N/A (2018). Read more (PubMed: 29180574) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Pig Tissue sections (Age P0 brain (Subventricular zone))
Permeabilization
Yes - 0.05% Triton
Specification
Age P0 brain (Subventricular zone)
Blocking step
TNB Blocking Buffer from Perkin Elmer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 0.5% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Apr 24 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up