Overview

  • Product name

  • Description

    Rabbit polyclonal to SF20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human SF20 aa 32-102.
    Sequence:

    VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSL GTSEDHQHFTCTIWRPQGKSY


    Database link: Q969H8

  • Positive control

    • Human pancreas tissue; RT4 and U251 MG cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 19 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Expressed in synovial tissue. Found in synovial fluid of patients with arthropaties.
  • Sequence similarities

    Belongs to the UPF0556 family.
  • Cellular localization

    Secreted. Endoplasmic reticulum-Golgi intermediate compartment.
  • Information by UniProt
  • Database links

  • Alternative names

    • C19orf10 antibody
    • Chromosome 19 open reading frame 10 antibody
    • CS010_HUMAN antibody
    • EUROIMAGE1875335 antibody
    • IL 25 antibody
    • IL 27 antibody
    • IL-25 antibody
    • IL25 antibody
    • IL27 antibody
    • IL27w antibody
    • Interleukin 25 antibody
    • Interleukin 27 working designation antibody
    • Interleukin-25 antibody
    • Interleukin25 antibody
    • R33729 1 antibody
    • R337291 antibody
    • SF20 antibody
    • Stromal cell derived growth factor antibody
    • Stromal cell derived growth factor SF20 antibody
    • Stromal cell-derived growth factor SF20 antibody
    • Uncharacterized protein C19orf10 precursor antibody
    • UPF0556 protein C19orf10 antibody
    see all

Images

  • All lanes : Anti-SF20 antibody (ab187919) at 1/100 dilution

    Lane 1 : RT4 cell lysates
    Lane 2 : U251 MG cell lysates

    Secondary
    All lanes : Swine anti-Rabbit HRP at 1/3000 dilution

    Predicted band size: 19 kDa

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling SF20 with ab187919 at 1/20 dilution.

References

ab187919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up