Overview

  • Product name
  • Description
    Rabbit polyclonal to SF3A3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IP, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Zebrafish, Rhesus monkey
  • Immunogen

    Synthetic peptide within Human SF3A3 aa 451-501 (C terminal). The exact sequence is proprietary. (NP_006793.1)
    Sequence:

    QIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGL L


    Database link: Q12874

  • Positive control
    • HeLa, 293T and NIH3T3 whole cell lysates; Human Breast Carcinoma, Colon Carcinoma, Glioblastoma, Ovarian Carcinoma and Prostate Carcinoma tissues; Mouse Colon Carcinoma CT26, Hybridoma Tumor, Renal Cell Carcinoma and Teratoma tissues.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 99% Tris buffered saline, 0.1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab176581 was affinity purified using an epitope specific to SF3A3 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 59 kDa.
IP Use at 2-5 µg/mg of lysate.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/50 - 1/250.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling SF3A3 with ab176581 at 1µg/ml.

  • All lanes : Anti-SF3A3 antibody (ab176581) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg
    Lane 5 : NIH3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 59 kDa


    Exposure time: 30 seconds
  • Detection of SF3A3 in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab176581 at 3 µg/mg lysate for IP (Lane 1). For WB detection ab176581 was used at 0.4 µg/ml. Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab176581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up