Overview

  • Product name

  • Description

    Rabbit polyclonal to SFI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Baboon
  • Immunogen

    Recombinant fragment corresponding to Human SFI1 aa 1003-1242.
    Sequence:

    HSARKQPRRPHFLLEPAQSQRPQKPQEHGLGMAQPAAPSLTRPFLAEAPT ALVPHSPLPGALSSAPGPKQPPTASTGPELLLLPLSSFMPCGAAAPARVS AQRATPRDKPPVPSSLASVPDPHLLLPGDFSATRAGPGLSTAGSLDLEAE LEEIQQQLLHYQTTKQNLWSCRRQASSLRRWLELNREEPGPEDQEVEQQV QKELEQVEMQIQLLAEELQAQRQPIGACVARIQALRQALC


    Database link: A8K8P3-1

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human bladder cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 148, 38 kDa (predicted molecular weight: 148, 144, 138, 122, 118, 142, 137 kDa).

Target

Images

  • Paraffin-embedded human bladder cancer tissue stained for SFI1 with ab230231 at 1/100 dilution in immunohistochemical analysis.

  • Anti-SFI1 antibody (ab230231) at 1/1000 dilution + HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 148, 144, 138, 122, 118, 142, 137 kDa
    Observed band size: 148,38 kDa
    why is the actual band size different from the predicted?

References

ab230231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up