Overview

  • Product name

  • Description

    Rabbit polyclonal to SFI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SFI1 aa 1003-1242.
    Sequence:

    HSARKQPRRPHFLLEPAQSQRPQKPQEHGLGMAQPAAPSLTRPFLAEAPT ALVPHSPLPGALSSAPGPKQPPTASTGPELLLLPLSSFMPCGAAAPARVS AQRATPRDKPPVPSSLASVPDPHLLLPGDFSATRAGPGLSTAGSLDLEAE LEEIQQQLLHYQTTKQNLWSCRRQASSLRRWLELNREEPGPEDQEVEQQV QKELEQVEMQIQLLAEELQAQRQPIGACVARIQALRQALC


    Database link: A8K8P3-1

  • Positive control

    • WB: A549 and HepG2 whole cell lysates. IHC-P: Human bladder cancer and endometrial cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 117,137,138,141,144,148 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-SFI1 antibody (ab230242) at 1/1000 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 117,137,138,141,144,148 kDa
    Observed band size: 148,85 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human bladder cancer tissue stained for SFI1 using ab230242 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tissue stained for SFI1 using ab230242 at 1/100 dilution in immunohistochemical analysis.

References

ab230242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up