Overview

  • Product name

  • Description

    Rabbit polyclonal to SFRP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide within Human SFRP5 aa 190-219 (internal sequence) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ADGLMEQMCSSDFVVKMRIKEIKIENGDRK


    Database link: Q5T4F7

  • Positive control

    • WB: Mouse heart tissue lysate. IHC-P: Human colon tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 36 kDa.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Relevance

    Secreted frizzled-related protein 5 (SFRP5) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP5 and SFRP1 may be involved in determining the polarity of photoreceptor cells in the retina. SFRP5 is highly expressed in the retinal pigment epithelium, and moderately expressed in the pancreas.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Frizzled related protein 1b antibody
    • FRP 1b antibody
    • FRP1b antibody
    • SARP 3 antibody
    • SARP3 antibody
    • Secreted apoptosis related protein 3 antibody
    • Secreted frizzled related protein 5 antibody
    • SFRP 5 antibody
    see all

Images

  • Anti-SFRP5 antibody (ab230425) at 1/1000 dilution + mouse heart tissue lysate at 35 µg

    Developed using the ECL technique.

    Predicted band size: 36 kDa

  • Formalin-fixed, paraffin-embedded human colon tissue stained for SFRP5 with ab230425 at 5 µg/ml in immunohistochemical analysis.

References

ab230425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up