Overview

  • Product name

    Anti-SFRS14/SUGP2 antibody
    See all SFRS14/SUGP2 primary antibodies
  • Description

    Rabbit polyclonal to SFRS14/SUGP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SFRS14/SUGP2 aa 187-283.
    Sequence:

    ESRDYDVDHPGEADSVLRGGSQVQARGRALNIVDQEGSLLGKGETQGLLT AKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDVTLG


    Database link: Q8IX01

  • Positive control

    • Human testis tissue; U-2 OS cells.
  • General notes

     This product was previously labelled as SFRS14

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    May play a role in mRNA splicing.
  • Tissue specificity

    Detected in adult testis, and in fetal brain and kidney.
  • Sequence similarities

    Contains 1 G-patch domain.
    Contains 2 SURP motif repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Arginine/serine rich splicing factor 14 antibody
    • arginine/serine-rich 14 antibody
    • Arginine/serine-rich-splicing factor 14 antibody
    • DKFZp779L2418 antibody
    • KIAA0365 antibody
    • Splicing factor antibody
    • Splicing factor, arginine/serine-rich 14 antibody
    • Sugp2 antibody
    • SUGP2_HUMAN antibody
    • SURP and G-patch domain-containing protein 2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling SFRS14/SUGP2 with ab204602 at 4µg/ml (green).

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling SFRS14/SUGP2 with ab204602 at 1/1000 dilution.

References

ab204602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up