Overview

  • Product name

    Anti-SFRS18 antibody
  • Description

    Rabbit polyclonal to SFRS18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SFRS18 aa 13-151.
    Sequence:

    PLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQREASGQQSMVEQPPGMMP NGQDMSTMESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPPPDQPWMPP TPGPMDIVPPSEDSNSQDSGEFAPDNRHIFNQNNHNFGG


    Database link: Q8TF01

  • Positive control

    • WB: Human kidney tissue. ICC/IF: HEK-293 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    SFRS18 is a putative alternative splicing factor belonging to the splicing factor SR family. It was identified as a factor that interacts with pinin (Pnn/DRS/memA), a cell-adhesion and nuclear protein of corneal epithelial cells. SFRS18 bears multiple arginine/serine-rich repeats found among the SR-related family of pre-mRNA processing factors. SFRS18 and pinin co-localize and are distributed as nuclear specks that correspond to the pre-splicing machinery.
  • Cellular localization

    Nuclear speckle
  • Database links

  • Alternative names

    • bA98I9.2 antibody
    • C 6 orf 111 antibody
    • C6orf111 antibody
    • chromosome 6 open reading frame 111 antibody
    • DKFZp 564B0769 antibody
    • DKFZp564B0769 antibody
    • HSPC 306 antibody
    • HSPC306 antibody
    • MGC 104269 antibody
    • MGC104269 antibody
    • RP11 98I9.2 antibody
    • RP11-98I9.2 antibody
    • Serine arginine rich splicing regulatory protein 130 antibody
    • Serine/arginine-rich splicing factor 18 antibody
    • SFRS 18 antibody
    • SFRS18 antibody
    • Sfrs18 protein antibody
    • splicing factor arginine/serine-rich 18 antibody
    • Splicing factor, arginine/serine-rich 130 antibody
    • SR related protein antibody
    • SR rich protein antibody
    • SRrp 130 antibody
    • SRrp130 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HEK-293 (human epithelial cell line from embryonic kidney) cells stained for SFRS18 (green) using ab243716 at 4 µg/ml in ICC/IF.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for SFRS18 using ab243716 at 1/50 dilution in immunohistochemical analysis.

References

ab243716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up