Overview

  • Product name
  • Description
    Rabbit polyclonal to SFRS3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide within Human SFRS3 aa 38-87 (N terminal). The exact sequence is proprietary.
    Sequence:

    SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS


    Database link: P84103

  • Positive control
    • SFRS3-transfected 293T cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab80291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Titre using peptide based assay 1/312500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May be involved in RNA processing in relation with cellular proliferation and/or maturation.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • arginine/serine-rich 3 antibody
    • Pre mRNA splicing factor SRP20 antibody
    • Pre-mRNA-splicing factor SRP20 antibody
    • Serine/arginine-rich splicing factor 3 antibody
    • Splicing factor antibody
    • Splicing factor arginine/serine rich 20 kD antibody
    • Splicing factor arginine/serine rich 3 antibody
    • SRp20 antibody
    • SRSF3 antibody
    • SRSF3_HUMAN antibody
    • X16 antibody
    see all

Images

  • Anti-SFRS3 antibody (ab80291) at 1 µg/ml + lysate from SFRS3-transfected 293T cells at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 19 kDa
    Observed band size: 25 kDa (why is the actual band size different from the predicted?)



    Gel concentration 12%

References

ab80291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up