Overview

  • Product name

  • Description

    Rabbit polyclonal to SFRS4/SRSF4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SFRS4/SRSF4 aa 1-180.
    Sequence:

    MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADD AVYELNGKDLCGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPT RTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSY SDMKRALEKLDGTEVNGRKIRLVEDKPGSR


    Database link: Q08170

  • Positive control

    • WB: HeLa whole cell lysate. IHC-P: Human tonsil and kidney tissue.
  • General notes

     This product was previously labelled as SFRS4

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/200 - 1/1000. Predicted molecular weight: 57 kDa.

Target

  • Function

    A probable role in alternative splice site selection during pre-mRNA splicing.
  • Sequence similarities

    Belongs to the splicing factor SR family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications

    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localization

    Nucleus speckle.
  • Information by UniProt
  • Database links

  • Alternative names

    • arginine/serine-rich 4 antibody
    • Pre mRNA splicing factor SRP75 antibody
    • Pre-mRNA-splicing factor SRP75 antibody
    • Serine/arginine-rich splicing factor 4 antibody
    • Splicing factor antibody
    • Splicing factor, arginine/serine rich 4 antibody
    • Splicing factor, arginine/serine rich, 75-KD antibody
    • SRP001LB antibody
    • SRP75 antibody
    • Srsf4 antibody
    • SRSF4_HUMAN antibody
    see all

Images

  • Anti-SFRS4/SRSF4 antibody (ab235606) at 1/200 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 57 kDa

  • Paraffin-embedded human tonsil tissue stained for SFRS4/SRSF4 using ab235606 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for SFRS4/SRSF4 using ab235606 at 1/100 dilution in immunohistochemical analysis.

References

ab235606 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up