Overview

  • Product name

  • Description

    Rabbit polyclonal to SFRS7/SRSF7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, IPmore details
    Unsuitable for: WB
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan, Platypus
  • Immunogen

    Synthetic peptide corresponding to Human SFRS7/SRSF7 aa 75-125.
    Sequence:

    SRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSR R


    Database link: NP_001026854.1

  • Positive control

  • General notes

     This product was previously labelled as SFRS7

     

Properties

Applications

Our Abpromise guarantee covers the use of ab137247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/5000. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    • Function

      Required for pre-mRNA splicing. Can also modulate alternative splicing in vitro. Represses the splicing of MAPT/Tau exon 10.
    • Tissue specificity

      Brain, liver, kidney and lung.
    • Sequence similarities

      Belongs to the splicing factor SR family.
      Contains 1 CCHC-type zinc finger.
      Contains 1 RRM (RNA recognition motif) domain.
    • Post-translational
      modifications

      Extensively phosphorylated on serine residues in the RS domain.
    • Cellular localization

      Nucleus.
    • Information by UniProt
    • Database links

    • Alternative names

      • 9G8 antibody
      • AAG3 antibody
      • arginine/serine-rich 7 antibody
      • HSSG1 antibody
      • RBM37 antibody
      • Serine/arginine-rich splicing factor 7 antibody
      • Splicing factor 9G8 antibody
      • Splicing factor antibody
      • Splicing factor, arginine/serine rich 7 antibody
      • SRSF7 antibody
      • SRSF7_HUMAN antibody
      • ZCCHC20 antibody
      • ZCRB2 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human colon carcinoma (left) and mouse renal cell carcinoma (right) tissues labelling SRSF7/SRSF7 with ab137247 at 1/5000 (0.2µg/ml) and 1/1000 (1µg/ml) . Detection: DAB.

    • Immunoprecipitation with ab137247 at 6µg/mg lysate. 1 mg of HeLa whole cell lysate used for IP (20% of IP loaded). Subsequent WB detection used an anti-SFRS7/SRSF7 antibody which recognizes a downstream epitope at 1 µg/ml. Detected by chemiluminescence with exposure time of 30 seconds.

    References

    ab137247 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab137247.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up