Overview

  • Product name

  • Description

    Rabbit polyclonal to SFT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human SFT aa 1-147.
    Sequence:

    MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVF FLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVS KVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM


    Database link: P51668

  • Positive control

    • SW620 and BT-474 cell line extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab185688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 17 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of CHIP, TRAF6 and TRIM63/MURF1. Ubiquitinates CHIP-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4.
  • Tissue specificity

    Ubiquitous. Up-regulated in livers of iron-overloaded patients with hereditary hemochromatosis.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • E2(17)KB1 antibody
    • SFT antibody
    • Stimulator of Fe transport antibody
    • UB2D1_HUMAN antibody
    • UBC 4/5 antibody
    • UBC4/5 antibody
    • UBC4/5 homolog antibody
    • UBC4/5, S. cerevisiae, homolog of antibody
    • UBCH 5 antibody
    • UBCH 5A antibody
    • UbcH5 antibody
    • UBCH5A antibody
    • Ube2d1 antibody
    • Ubiquitin carrier protein antibody
    • Ubiquitin carrier protein D1 antibody
    • Ubiquitin conjugating enzyme E2 17 kDa 1 antibody
    • Ubiquitin conjugating enzyme E2 D1 antibody
    • Ubiquitin conjugating enzyme E2D 1 (UBC4/5 homolog yeast) antibody
    • Ubiquitin conjugating enzyme E2D 1 antibody
    • Ubiquitin conjugating enzyme UBCH5A antibody
    • Ubiquitin protein ligase D1 antibody
    • Ubiquitin-conjugating enzyme E2 D1 antibody
    • Ubiquitin-conjugating enzyme E2(17)KB 1 antibody
    • Ubiquitin-conjugating enzyme E2-17 kDa 1 antibody
    • Ubiquitin-protein ligase D1 antibody
    see all

Images

  • All lanes : Anti-SFT antibody (ab185688) at 1/500 dilution

    Lane 1 : SW620 cell line extract
    Lane 2 : BT-474 cell line extract

    Predicted band size: 17 kDa

References

ab185688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up